Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acidithiobacillus ferrooxidans NADH-quinone oxidoreductase subunit K(nuoK)

Recombinant Acidithiobacillus ferrooxidans NADH-quinone oxidoreductase subunit K(nuoK)

SKU:CSB-CF476522AWH

Regular price €1.388,95 EUR
Regular price Sale price €1.388,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270))

Uniprot NO.:B7J7T5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNAGQPTLAAYLILGAMLFSIGVVGVFLNRKNVIILLMAIELLLLAVNINLVAFSRYLGN LDGQVFVFFILTVAAAEAAIGLAILVAYFRNRHSINVDDIDELRG

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K

Gene Names:Name:nuoK Ordered Locus Names:AFE_2620

Expression Region:1-105

Sequence Info:full length protein

View full details