Gene Bio Systems
Recombinant Acidianus two-tailed virus Uncharacterized protein ORF134
Recombinant Acidianus two-tailed virus Uncharacterized protein ORF134
SKU:CSB-CF664991ACAM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acidianus two-tailed virus (ATV)
Uniprot NO.:Q3V4U5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQVENVSLSQIIANPYLPPFSTTLFEIVIFTFIMITLYLIFRGSGLVRRRLVLLLIAIY VIVLQLFFTPYEYTTARLLPNGTVDYVVYTSQANIVMALDVLAGLMLILAVVYIILDYLR GFGKGDEEEGVIDL
Protein Names:Recommended name: Uncharacterized protein ORF134
Gene Names:
Expression Region:1-134
Sequence Info:full length protein
