Gene Bio Systems
Recombinant Acidianus filamentous virus 2 Uncharacterized protein ORF83(ORF83)
Recombinant Acidianus filamentous virus 2 Uncharacterized protein ORF83(ORF83)
SKU:CSB-CF687997ADAI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acidianus filamentous virus 2 (isolate Italy/Pozzuoli) (AFV-2)
Uniprot NO.:Q573F1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKQIQSSDKENYDLLLLLPNVYAMTLLIITNTLLIILSYSVLLNNDVLLTLTTIRNIPI SIAPTMAIESTIVSSTSLITTSP
Protein Names:Recommended name: Uncharacterized protein ORF83
Gene Names:ORF Names:ORF83
Expression Region:1-83
Sequence Info:full length protein
