Gene Bio Systems
Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF72 (ORF72)
Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF72 (ORF72)
SKU:CSB-CF397889ATY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acidianus bottle-shaped virus (isolate Italy/Pozzuoli) (ABV)
Uniprot NO.:A4ZUC0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MANEKTLFYALLGVGAIIVVLSTTGYLNNASNLSIAILFAVFAIAIASVYEFREPEIVVK PAKPTFEEKVIG
Protein Names:Recommended name: Putative transmembrane protein ORF72
Gene Names:ORF Names:ORF72
Expression Region:1-72
Sequence Info:full length protein
