Gene Bio Systems
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R213(MIMI_R213)
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R213(MIMI_R213)
SKU:CSB-CF719524ADAZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acanthamoeba polyphaga mimivirus (APMV)
Uniprot NO.:Q5UQ28
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYSGRTSYDENTRQLYKLDDNGNFVFVENISLDNYFDLLIDIYRTNDPIDELDCCFKLHD MDTNTNNISDIIKASHSLPVNMGHIDPVFYLGYPVIFIIGVTYFSIIASRKINPSDRLLN EIKEYRLTCQNVYRKKFSINFV
Protein Names:Recommended name: Uncharacterized protein R213
Gene Names:Ordered Locus Names:MIMI_R213
Expression Region:1-142
Sequence Info:full length protein
