Gene Bio Systems
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L682(MIMI_L682)
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L682(MIMI_L682)
SKU:CSB-CF713191ADAZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acanthamoeba polyphaga mimivirus (APMV)
Uniprot NO.:Q5UNU7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGNYISFKKEFGLILVGAIIFTASYLWKDLLLEIEEKYFPKGYGLMWRSIYTILVTVILV LVAIHLKNQFGLVNKDSKDPKDKSIEFDDSPIRDGSSGTPDNSNEPTDLSVETS
Protein Names:Recommended name: Uncharacterized protein L682
Gene Names:Ordered Locus Names:MIMI_L682
Expression Region:1-114
Sequence Info:full length protein