Gene Bio Systems
Recombinant Abrus precatorius Abrin-a,partial
Recombinant Abrus precatorius Abrin-a,partial
SKU:CSB-EP319970AAC
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P11140
Gene Names:N/A
Organism:Abrus precatorius (Indian licorice) (Glycine abrus)
AA Sequence:QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN
Expression Region:1-251aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged
MW:33.6 kDa
Alternative Name(s):rRNA N-glycosidase
Relevance:The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin. The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis.
Reference:"The complete amino acid sequence of the A-chain of abrin-a, a toxic protein from the seeds of Abrus precatorius." Funatsu G., Taguchi Y., Kamenosono M., Yanaka M. Agric. Biol. Chem. 52:1095-1097(1988)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin.; FUNCTION
Involvement in disease:
Subcellular Location:
Protein Families:Ribosome-inactivating protein family, Type 2 RIP subfamily
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
