Skip to product information
1 of 1

GeneBio Systems

EXT Monoclonal Antibody,(for General Species)

EXT Monoclonal Antibody,(for General Species)

SKU:MAV768Ge21

Regular price €663,95 EUR
Regular price Sale price €663,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100uL

Target Name: EXT

Target Full Name: Exenatide

Alternative Names: Byetta; Bydureon; Exendin-4

Lead time: 1-3 days

Reactivity Species: General Species

UniProt ID: P26349

Gene ID: -

Featured Series: Monoclonal Antibodies(Primary Abs)

Category type: Monoclonal Antibody

Conjugation: -

Concentration: 1mg/mL

Host: Mouse

Potency (Clone Number): C2

Ig Isotype: IgG2a Kappa

Conjugated Ab Catalog: -

Immunogen Catalog Number: CPV768Ge11

Immunogen Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Buffer: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol

State: Liquid

Purification: Protein A + Protein G affinity chromatography

Application: WB;IHC;ICC;IP

USAGE: Immunohistochemistry: 5-20µg/mL; Immunofluorescence:5-20µg/mL; Optimal working dilutions must be determined by end user.

Storage: Store at 2°C to 8°C for frequent use, -20°C for 12 months

Expiration: Stable for 12 months if correctly stored.

Reference: -

View full details