GeneBio Systems
EXT conjugated BSA, General species
EXT conjugated BSA, General species
SKU:CPV768Ge11
Couldn't load pickup availability
Size: 50ug
Featured Series: Conjugated small molecules
Lead time: 7-10 days
Target Name: EXT
Target Full Name: Exenatide
Alternative Names: Byetta; Bydureon; Exendin-4
Species: General species
Expression System: Protein conjugation
Host: -
Uniprot ID: P26349
Gene ID: -
Region: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Molecular Weight: -
Tags: Non Tag
Endotoxin Level: <1.0EU per 1µg (determined by the LAL method)
Isoelectric Point: -
Storage: Store at 2-8°C for one month,-80°C for 12 months
Expiration: Stable for 12 months if correctly stored.
Buffer: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300
State: Freeze-dried powder
Purity: ≥90%
Conjugation: BSA
Application: Immunogen; SDS-PAGE; WB
Subcellular Location: -
Research Area:
Reference: -
