View larger

Recombinant Danio rerio Secretory carrier-associated membrane protein 5(scamp5)

CSB-CF744024DIL

Recombinant Danio rerio Secretory carrier-associated membrane protein 5(scamp5)

See below for Detailed Description

More details

CAD$1,578.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6P0C7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAENNFPPLPRFIPLKPCFYQDFNEIPDQHRTMCKRLYYLWILNSATLAVNLIGCLAWMC GGGGATNFGMAILWLILFTPCSYVCWFRPIYKAFKSDSSFNFMAFFFVFMAQVVISIIQT VGIPGWGVCGWLATITFFSTNIGSAVVMLIPTIMFTAVAVLSFIALTKVHNFYRGSGGSM SKAQEEWTSGAWKNPHVQQAAQQAAMGAAQGAMQGQQYSAAPTYNYDDPM

Protein Names:Recommended name: Secretory carrier-associated membrane protein 5 Short name= Secretory carrier membrane protein 5

Gene Names:Name:scamp5

Expression Region:1-230

Sequence Info:full length protein

30 other products in the same category: