View larger

Recombinant Xenopus tropicalis Voltage-gated hydrogen channel 1(hvcn1)

CSB-CF702791XBF

Recombinant Xenopus tropicalis Voltage-gated hydrogen channel 1(hvcn1)

See below for Detailed Description

More details

CAD$1,578.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q5M8L8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGCLRHFTSVGDDTKKKAWKEEDVEVAHEEEPKNTPHPFIASYSFRGALKWLFSSHKFQ IVIICLVILDALFVLVEVLLDLELLAEKVDHIIPEIFHYLSISVLSFFILEIAGKLYAFR LEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGIIVSVKT QAEDKIHRLKENQESLLEKVAHLEQQCAQQEQEIVRLQTLLQQHNVFPAS

Protein Names:Recommended name: Voltage-gated hydrogen channel 1 Alternative name(s): Hydrogen voltage-gated channel 1 Short name= HV1

Gene Names:Name:hvcn1

Expression Region:1-230

Sequence Info:full length protein

30 other products in the same category: