View larger

Recombinant Dictyostelium discoideum Dolichyldiphosphatase 1(dolpp1)

CSB-CF801196DKK

Recombinant Dictyostelium discoideum Dolichyldiphosphatase 1(dolpp1)

See below for Detailed Description

More details

CAD$1,577.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dictyostelium discoideum (Slime mold)

Uniprot NO.:Q86IX2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEQEVYTALTFVELTTVHYQHDDPFGLFNAYVTLIPIAIAIGVITLILFRRDVRTISIFL GLLFSECTNYVLKKSIKEHRPTMWKELRKQSYGMPSSHSQFMFFFAVLMTLFYLKKRIRF GSKILPIISVTFLFFLAAGVAYSRVHLYYHTAKQVFCGSFIGICLGFIWYGVIEYIFRPY LFPIIINHPIGKYFYLRDSSEIEDLLNFEYTNVMNKVKTINKTKPIKTK

Protein Names:Recommended name: Dolichyldiphosphatase 1 EC= 3.6.1.43 Alternative name(s): Dolichyl pyrophosphate phosphatase 1

Gene Names:Name:dolpp1 ORF Names:DDB_G0274591

Expression Region:1-229

Sequence Info:full length protein

30 other products in the same category: