View larger

Recombinant Chicken Lysosomal-associated transmembrane protein 4A(LAPTM4A)

CSB-CF730528CH

Recombinant Chicken Lysosomal-associated transmembrane protein 4A(LAPTM4A)

See below for Detailed Description

More details

CAD$1,577.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5ZML7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFKRSRDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMGILLTVEVTHPNVVPTVNIQY EVIGNYYASERMAENACVLFAISLLMFTISAMMVYGAIAHRVGWLIPFFCYQLFDFVVSC LVAISSLTYLPRIKDYLDQLPDFPYKDDLLSLDSSCLLFIVLVFFALFIILKAYLINCVW NCYKYISNRNLPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPSPSYIPA

Protein Names:Recommended name: Lysosomal-associated transmembrane protein 4A

Gene Names:Name:LAPTM4A ORF Names:RCJMB04_1k20

Expression Region:1-229

Sequence Info:full length protein

30 other products in the same category: