View larger

Recombinant Vitis vinifera Chloroplast envelope membrane protein(cemA)

CSB-CF608703VFQ

Recombinant Vitis vinifera Chloroplast envelope membrane protein(cemA)

See below for Detailed Description

More details

CAD$1,577.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:Q0ZJ08

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTKKKAFTPLLYLASIVFLPWWISLSLNKSLESWVTNWWNTRQSETFLNDIQEKSILEKF IELEELFLLDEMIKECPETHLQKLRMGIHKETIQLIKMYNEDPIHTILHFSTNIICFVIL SGYSILGNEELLILNSWIQQFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKD FGFAHNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND

Protein Names:Recommended name: Chloroplast envelope membrane protein

Gene Names:Name:cemA

Expression Region:1-229

Sequence Info:full length protein

30 other products in the same category: