View larger

Recombinant Escherichia coli Molybdenum transport system permease protein modB(modB)

CSB-CF360194ENV

Recombinant Escherichia coli Molybdenum transport system permease protein modB(modB)

See below for Detailed Description

More details

CAD$1,577.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P0AF01

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKALLDSVLHLPLVLPPV VVGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDV KLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRT IPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARISRERAGR

Protein Names:Recommended name: Molybdenum transport system permease protein modB

Gene Names:Name:modB Synonyms:chlJ Ordered Locus Names:b0764, JW0747

Expression Region:1-229

Sequence Info:full length protein

30 other products in the same category: