View larger

Recombinant Helicobacter pylori Uncharacterized membrane protein HP_1331 (HP_1331)

CSB-CF517894HUV

Recombinant Helicobacter pylori Uncharacterized membrane protein HP_1331 (HP_1331)

See below for Detailed Description

More details

CAD$1,576.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Uniprot NO.:O25889

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHEFLKAFKDAFPHTISILLGYLLMGMTFGMLLVQQGYDYKVALFMSLFIYAGAVQFVAI TLLSAQASLMNVVIVSLLVNARQTCYALSMLDRFKNTKWRLPYLAHALTDETFALLNLYA PKEGVSEKDFIFSISLLNHSYWIFGSLVGSLVGSHFSFDTQGMEFVMTAIFIVLFMEQYK RTTNHKNAWLGIVIAVVCLALFGTEYFLLIALVLMVLALMLFRKQLEC

Protein Names:Recommended name: Uncharacterized membrane protein HP_1331

Gene Names:Ordered Locus Names:HP_1331

Expression Region:1-228

Sequence Info:full length protein

30 other products in the same category: