View larger

Recombinant Histidine transport system permease protein hisQ(hisQ)

CSB-CF358235SWW

Recombinant Histidine transport system permease protein hisQ(hisQ)

See below for Detailed Description

More details

CAD$1,576.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella typhi

Uniprot NO.:P0A2J0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVTGLIFEGYTTLIRGVP DLVLMLLIFYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP KGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT QLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVGVKRADL

Protein Names:Recommended name: Histidine transport system permease protein hisQ

Gene Names:Name:hisQ Ordered Locus Names:STY2583, t0511

Expression Region:1-228

Sequence Info:full length protein

30 other products in the same category: