View larger

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Electron transport complex protein RnfE(rnfE)

CSB-CF348121BWZ

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Electron transport complex protein RnfE(rnfE)

See below for Detailed Description

More details

CAD$1,575.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Uniprot NO.:P57218

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIKSFLNNRLWKNNSSLVQLLGLCPVLAMTTNAINAIGLGMTTTLVLTITNTIISSFRK IIPKDLRIPIYMMIISSVVTSIEMLLHAYTFNLYQSLGIFIPLIVTNCIIVGRADLIAYK SSIVESFFDGIFIGLGSMFAMFAVGSIREILGNGTLFFGANKIISNIHSSVFFTLLDKKF TIILAVFPPGGFLILGFLIAIKNFIDLYYKKNTIKNIEQCSCSNKIK

Protein Names:Recommended name: Electron transport complex protein RnfE

Gene Names:Name:rnfE Ordered Locus Names:BU118

Expression Region:1-227

Sequence Info:full length protein

30 other products in the same category: