View larger

Recombinant Rat Gap junction beta-2 protein(Gjb2)

CSB-CF009452RA

Recombinant Rat Gap junction beta-2 protein(Gjb2)

See below for Detailed Description

More details

CAD$1,574.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P21994

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEE IKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDC FISRPTEKTVFTVFMISVSGICILLNITELCYLFIRYCSGKSKRPV

Protein Names:Recommended name: Gap junction beta-2 protein Alternative name(s): Connexin-26 Short name= Cx26

Gene Names:Name:Gjb2 Synonyms:Cxn-26

Expression Region:1-226

Sequence Info:Full length protein

30 other products in the same category: