View larger

Recombinant Xenopus laevis Phosphatidate phosphatase PPAPDC1B(ppapdc1b)

CSB-CF746808XBE

Recombinant Xenopus laevis Phosphatidate phosphatase PPAPDC1B(ppapdc1b)

See below for Detailed Description

More details

CAD$1,574.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6GQ62

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWLYRNPYVVSDRIPTNSMFLISFLTPLSVVALARLFWKADGTDSREAGLAASLSLALNG IFTNTVKLIVGRPRPDFLFRCFPDGQESPGLHCTGDPELVIEGRKSFPSGHSSFAFAGLG FTALYLAGKLRCFSPCGRGHSWRLCASLIPLLCAIAIALSRTCDYKHHWQDVVVGAFIGL FFAFLCYRQYYPSLVERDCHQPYRNKGRMSGAQERKLSTPGYSLDV

Protein Names:Recommended name: Phosphatidate phosphatase PPAPDC1B EC= 3.1.3.4 Alternative name(s): Phosphatidic acid phosphatase type 2 domain-containing protein 1B

Gene Names:Name:ppapdc1b

Expression Region:1-226

Sequence Info:full length protein

30 other products in the same category: