View larger

Recombinant Triticum aestivum CASP-like protein STG(STG)

CSB-CF518752TQN

Recombinant Triticum aestivum CASP-like protein STG(STG)

See below for Detailed Description

More details

CAD$1,574.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Triticum aestivum (Wheat)

Uniprot NO.:E6Y2A0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTSEAATVIPVYDVAPGQGAPSKAPAAAPPSAAAAAPAAAATTTAPRKFPMRFFRRSDR GSRCMAFLDFLLRIAAFGPALAAAIATGTSDETLSVFTEFFQFRARFDEFPAFLFLMVAS AIAAGYLLLSLPFSAVVVLRPQTTVLRLLLLVCDTIMLGLLTAGAAAAAAIVDLAHSGNE RANWVPICMQFHGFCRRTSGAVVASFLSVFIFVLLVVLAAFSIRKR

Protein Names:Recommended name: CASP-like protein STG Alternative name(s): Salt tolerence protein Short name= TaSTG

Gene Names:Name:STG

Expression Region:1-226

Sequence Info:full length protein

30 other products in the same category: