View larger

Recombinant Respiratory nitrate reductase 2 gamma chain(narV)

CSB-CF360210EOD

Recombinant Respiratory nitrate reductase 2 gamma chain(narV)

See below for Detailed Description

More details

CAD$1,574.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P0AF33

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIQYLNVFFYDIYPYICATVFFLGSWLRYDYGQYTWRASSSQMLDKRGMVIWSNLFHIGI LGIFFGHLFGMLTPHWMYAWFLPVAAKQLMAMVLGGICGVLTLIGGAGLLWRRLTNQRVR ATSTTPDIIIMSILLIQCLLGLSTIPFSAQYPDGSEMMKLVGWAQSIVTFRGGSSEMLNG VAFVFRLHLVLGMTIFLLFPFTRLVHVWSAPFEYFTRRYQIVRSRR

Protein Names:Recommended name: Respiratory nitrate reductase 2 gamma chain EC= 1.7.99.4

Gene Names:Name:narV Ordered Locus Names:Z2247, ECs2068

Expression Region:1-226

Sequence Info:full length protein

30 other products in the same category: