View larger

Recombinant Campylobacter curvus ATP synthase subunit a(atpB)

CSB-CF015070CWB

Recombinant Campylobacter curvus ATP synthase subunit a(atpB)

See below for Detailed Description

More details

CAD$1,572.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Campylobacter curvus (strain 525.92)

Uniprot NO.:A7GYS2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKDLFLFSDLIYHNHLFVYAFHFCLVAIIVVLVAKLATSKMQLVPRGLQNIVEAYLEGVI SMGRDTLGSEALARKYLPLVATIGFVVFFSNAIGIIPGFESPTSSLNLTLTLALIVFFYY HFEGIKKNGFFKYFGHFMGPSKALAPLMFPVEIISHLSRIVSLSFRLFGNIKGDDLFLLV MLTLAPWFAPLPAYALLTLMAVLQTFIFMMLTYVYLAGAVAIEEH

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6

Gene Names:Name:atpB Ordered Locus Names:Ccur92_10600 ORF Names:CCV52592_0790

Expression Region:1-225

Sequence Info:full length protein

30 other products in the same category: