View larger

Recombinant Archaeoglobus fulgidus Cobalamin synthase 1(cobS1)

CSB-CF523207DOC

Recombinant Archaeoglobus fulgidus Cobalamin synthase 1(cobS1)

See below for Detailed Description

More details

CAD$1,572.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Uniprot NO.:O30198

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALDLLRSSLGFLTTLPVKGDVDVLRRNLWVFSFVGIFIGSVISIPAVLGFWFLCVLLYV AIEGVNHIDGLADFGDAFFAPEERKKVAIKDLNLGTGGAVFLCVYFLILFYSFQRVSAFY IIFSQVLAKFSMLLLLTTSKPAWQGMTGFMMEFARKRDVVIGSLPLLLVVLKPLAVFPLL FAITISLLVKRYAEEKFGGVSGDVVGASNCLVFAGSLLVCYFLAD

Protein Names:Recommended name: Cobalamin synthase 1 EC= 2.-.-.-

Gene Names:Name:cobS1 Ordered Locus Names:AF_0037

Expression Region:1-225

Sequence Info:full length protein

30 other products in the same category: