View larger

Recombinant Salmonella typhimurium Surface presentation of antigens protein spaP(spaP)

CSB-CF336767SXB

Recombinant Salmonella typhimurium Surface presentation of antigens protein spaP(spaP)

See below for Detailed Description

More details

CAD$1,571.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Uniprot NO.:P40700

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGNDISLIALLAFSTLLPFIIASGTCFVKFSIVFVMVRNALGLQQIPSNMTLNGVALLLS MFVMWPIMHDAYVYFEDEDVTFNDISSLSKHVDEGLDGYRDYLIKYSDRELVQFFENAQL KRQYGEETETVKRDKDEIEKPSIFALLPAYALSEIKSAFKIGFYLYLPFVVVDLVVSSVL LALGMMMMSPVTISTPIKLVLFVALDGWTLLSKGLILQYMDIAT

Protein Names:Recommended name: Surface presentation of antigens protein spaP

Gene Names:Name:spaP Ordered Locus Names:STM2890

Expression Region:1-224

Sequence Info:full length protein

30 other products in the same category: