View larger

Recombinant Bovine Synaptogyrin-2(SYNGR2)

CSB-CF023012BO

Recombinant Bovine Synaptogyrin-2(SYNGR2)

See below for Detailed Description

More details

CAD$1,571.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A7E3W5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESGAYGAPRAGGSFDLRRFLKQPQVVVRAVCLVFALIVFSCIFGEGYSNTHDSQQQYCV FNRNEDACRYGSAIGVLAFLASAFFFVVDIYFPQISNATDRKYLVIGDLLFSALWTFLWF VGFCFLTNQWAATKKNDVHVEADSARAAITFSFFSIFSWCVLAFLAYQRYKAGVDEFIQN YVDPTPDPSTAYASYPGVPADTYQQPPFTQNAESTEGYQPPPVY

Protein Names:Recommended name: Synaptogyrin-2 Alternative name(s): Cellugyrin

Gene Names:Name:SYNGR2

Expression Region:1-224

Sequence Info:Full length protein

30 other products in the same category: