View larger

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_113 (MPN_113)

CSB-CF304271MLW

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_113 (MPN_113)

See below for Detailed Description

More details

CAD$1,570.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75449

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVYQTIANFGTNILESLGLEAALSPTLSNTYIYGIPVLGAIFSGLITKKLTKSTAKSLI VQALFVILGTLAFLVITLASPAKPETGAFNQATLWIAFVVICFIMFFIGANRSIFWSTIT ELKVNKEIVGLAVGFISIIGFSKDVWLSPLLTGTTNQFIVKNSQGTSFYSQQALVAWAIF ALINACLALLVTYMIVRKVKYGKVWVNPKFKKVFALGEQQYGH

Protein Names:Recommended name: Uncharacterized protein MPN_113

Gene Names:Ordered Locus Names:MPN_113 ORF Names:C09_orf223, MP041

Expression Region:1-223

Sequence Info:full length protein

30 other products in the same category: