View larger

Recombinant Arabidopsis thaliana PRA1 family protein B5(PRA1B5)

CSB-CF878652DOA

Recombinant Arabidopsis thaliana PRA1 family protein B5(PRA1B5)

See below for Detailed Description

More details

CAD$1,570.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9M012

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSTNPPVLPISTTATDTTNQPPIVTAVVESQPPVVRAFVNGVTETVCGGLSRSRPWSEL LDRSAFTKPDSLSEAGTRFRKNSSYFRVNYVCIVALILGFSLLAHPFSLILLLCLAASWL FLYLFRPSDRPLILFGRSFSEYETLGGLILSTIAVIFFTSVGSVLISALMIGIATICVHG AFRAPDDLFLDEQDHAASGFLSFIGVPAIPSVAPSASSAASPV

Protein Names:Recommended name: PRA1 family protein B5 Short name= AtPRA1.B5

Gene Names:Name:PRA1B5 Ordered Locus Names:At5g01640 ORF Names:F7A7.160

Expression Region:1-223

Sequence Info:full length protein

30 other products in the same category: