View larger

Recombinant Sepia officinalis Cytochrome c oxidase subunit 1(COI)

CSB-CF855428SYJ

Recombinant Sepia officinalis Cytochrome c oxidase subunit 1(COI)

See below for Detailed Description

More details

CAD$1,570.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sepia officinalis (Common cuttlefish)

Uniprot NO.:Q8WEW3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IGTLYFIFGIWSGLLGTSLSLMIRTELGKPGSLLNDDQLYNVVVTAHGFVMIFFLVMPIM IGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSAVESGAGTGWTVYPPLSS NISHAGPSVDLAIFSLHLAGVSSILGAINFITTIMNMRWEGLQMERLPLFVWSVFITAIL LLLSLPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQHLFWF

Protein Names:Recommended name: Cytochrome c oxidase subunit 1 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide I

Gene Names:Name:COI

Expression Region:1-223

Sequence Info:full length protein

30 other products in the same category: