View larger

Recombinant Arabidopsis thaliana Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase

CSB-CF526177DOA

Recombinant Arabidopsis thaliana Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase

See below for Detailed Description

More details

CAD$1,570.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O48962

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEELAHPYVPRDLNLPGYVPISMSMSSIVSIYLGSSLLVVSLVWLLFGRKKAKLDKLLMC WWTFTGLTHVILEGYFVFSPEFFKDNTSAYLAEVWKEYSKGDSRYVGRDSAVVSVEGITA VIVGPASLLAIYAIAKEKSYSYVLQLAISVCQLYGCLVYFITAILEGDNFATNSFYYYSY YIGANCWWVLIPSLISFRCWKKICAAAAIANNNVETKTKKKTR

Protein Names:Recommended name: Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase EC= 5.3.3.5 Alternative name(s): Cholestenol Delta-isomerase Delta(8)-Delta(7) sterol isomerase Short name= D8-D7 sterol isomerase

Gene Names:Ordered Locus Names:At1g20050 ORF Names:T20H2.18

Expression Region:1-223

Sequence Info:full length protein

30 other products in the same category: