View larger

Recombinant Prosthecochloris aestuarii ATP synthase subunit a 1(atpB1)

CSB-CF472586EYX

Recombinant Prosthecochloris aestuarii ATP synthase subunit a 1(atpB1)

See below for Detailed Description

More details

CAD$1,570.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Prosthecochloris aestuarii (strain DSM 271 / SK 413)

Uniprot NO.:B4S798

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHLSGDDVIVWQYGVVKLNQTIVMTWVIMVFLAGGSAFLTRRLSSGIRISRWQSFLEMIV TMAMQQIREIGLRQPEKYLSYLATLFLFVATAVLFTIIPGYEPPTGSLSTTAALALSVFV AVPLYGIERVGFGAYLKSYMKPTFIMLPFNIISEFSRTLALAVRLFGNMMSGVMIIGILL GIAPLFFPVLMSVLGLLTGMVQAYIFSMLATVYIAAATKSRDE

Protein Names:Recommended name: ATP synthase subunit a 1 Alternative name(s): ATP synthase F0 sector subunit a 1 F-ATPase subunit 6 1

Gene Names:Name:atpB1 Ordered Locus Names:Paes_0892

Expression Region:1-223

Sequence Info:full length protein

30 other products in the same category: