View larger

Recombinant Human Lipoma HMGIC fusion partner-like 3 protein(LHFPL3)

CSB-CF769779HU

Recombinant Human Lipoma HMGIC fusion partner-like 3 protein(LHFPL3)

See below for Detailed Description

More details

CAD$1,569.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q86UP9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQAGYFG LFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIICFTLFFFCNT ATVYKICAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAI IGILDALILSFLAFVLGNRQDSLMAEELKAENKVLLSQYSLE

Protein Names:Recommended name: Lipoma HMGIC fusion partner-like 3 protein

Gene Names:Name:LHFPL3 Synonyms:LHFPL4

Expression Region:1-222

Sequence Info:full length protein

30 other products in the same category: