View larger

Recombinant Bacillus licheniformis Protease prsW(prsW)

CSB-CF714636BQU

Recombinant Bacillus licheniformis Protease prsW(prsW)

See below for Detailed Description

More details

CAD$1,569.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Uniprot NO.:Q65I04

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFGIISAGLAPGIALLMYFYLKEKYESEPIHMVIRLFILGVLLVFPTMFIQYVLEKEHIS EGSFVVSFLTSGFLEEFLKWFLLMVSTFQHIDFDEHYDGIVYGTSLSLGFATLENILYLI GNGVEYAFMRALLPVSSHALFGVIMGFYIGKARFSDSKTKMKWLLCSLFIPALLHGLYDY ILLALKNWIYFMLPFMAFLWWFGLRKAKKARSVKTGGQPLQQ

Protein Names:Recommended name: Protease prsW EC= 3.4.-.- Alternative name(s): Protease responsible for activating sigma-W

Gene Names:Name:prsW Ordered Locus Names:BLi02432, BL02223

Expression Region:1-222

Sequence Info:full length protein

30 other products in the same category: