View larger

Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf14(wtf14)

CSB-CF525587SXV

Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf14(wtf14)

See below for Detailed Description

More details

CAD$1,569.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O74512

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENNHHLAKDSLDELNPKRGKGEHETQVSQYTVVEEATIPQSLVKTSRPADHKVMEASKV ADTRTAWSTKIPAVLLPVFVINIALFKYLVFANFSTKDRVLFGLGNGGINIFSMWLLLAT YETWFRSIKEVIVACGAGIRSFPQKRGVNMLYAILKLTFVNAFAIPLLMFFRSHFEQWRL GCPLVERVIGVMLNVAYFIIEIGSFFKILINANFTRKSWFIH

Protein Names:Recommended name: Uncharacterized protein wtf14

Gene Names:Name:wtf14 Synonyms:wtf15 ORF Names:SPCC663.02

Expression Region:1-222

Sequence Info:full length protein

30 other products in the same category: