View larger

Recombinant Saccharomyces cerevisiae Protein ORM1(ORM1)

CSB-CF345664SVG

Recombinant Saccharomyces cerevisiae Protein ORM1(ORM1)

See below for Detailed Description

More details

CAD$1,569.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P53224

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTELDYQGTAEAASTSYSRNQTDLKPFPSAGSASSSIKTTEPVKDHRRRRSSSIISHVEP ETFEDENDQQLLPNMNATWVDQRGAWIIHVVIIILLKLFYNLFPGVTTEWSWTLTNMTYV IGSYVMFHLIKGTPFDFNGGAYDNLTMWEQIDDETLYTPSRKFLISVPIALFLVSTHYAH YDLKLFSWNCFLTTFGAVVPKLPVTHRLRISIPGITGRAQIS

Protein Names:Recommended name: Protein ORM1

Gene Names:Name:ORM1 Ordered Locus Names:YGR038W

Expression Region:1-222

Sequence Info:full length protein

30 other products in the same category: