View larger

Recombinant Synechococcus sp. Cytochrome b6(petB)

CSB-CF340940FQA

Recombinant Synechococcus sp. Cytochrome b6(petB)

See below for Detailed Description

More details

CAD$1,569.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Uniprot NO.:P28056

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFTKEVTDSKLYKWFNERLEIQAISDDISSKYVPPHVNIFYCLGGITLTCFIIQFATGFA MTFYYKPTVAEAFTSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHIFRVYLTGGFKRP RELTWITGVIMATITVSFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDQMVELLRGGA SVGQATLTRFYSLHTFVLPWLIAVFMLAHFLMIRKQGISGPL

Protein Names:Recommended name: Cytochrome b6

Gene Names:Name:petB Ordered Locus Names:SYNPCC7002_A0842

Expression Region:1-222

Sequence Info:full length protein

30 other products in the same category: