View larger

Recombinant Anopheles arabiensis NADH-ubiquinone oxidoreductase chain 4(ND4)

CSB-CF015079AKS

Recombinant Anopheles arabiensis NADH-ubiquinone oxidoreductase chain 4(ND4)

See below for Detailed Description

More details

CAD$1,568.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Anopheles arabiensis (Mosquito)

Uniprot NO.:P51898

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SLVGGVLISLVCLRQTDLKALIAYSSVAHMGIVLSGLLTMTYWGLTGSYALMIAHGLCSS GLFCLANISYERMGSRSLLINKGLLNFMPTLSLWWFLLCSGNMAAPPTLNLLGEISLLNS IVSWSWITMIMLSFLSFFSAAYSLYLFAYSQHGKIYSGVYFFSVGTTREFLLLMLHWLPL NLLILKSNFCMLWIYLNSLKKMLICGVNDMKLFILDRELFS

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4

Gene Names:Name:ND4

Expression Region:1-221

Sequence Info:full length protein

30 other products in the same category: