View larger

Recombinant Rhodobacter sphaeroides CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA)

CSB-CF663097RLF

Recombinant Rhodobacter sphaeroides CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA)

See below for Detailed Description

More details

CAD$1,568.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Uniprot NO.:Q3IYX7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNWSIPNILTVLRLLAAPGVAVMFLYFHRPWADWFALTLFILAAVTDFFDGYLARLWKQE SKFGAMLDPIADKAMVVIALVIITGYSGMNPWLILPVTLILFREVFVSGLREFLGAKASL LKVTKLAKWKTTAQMVAIAILFLGTGLEHLEGIARQGMTWEQYARAVSAGEADPIRSCGM HGCSSYATWLGLALIWIAAALTFITGWDYFRKALPYLKDEK

Protein Names:Recommended name: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase EC= 2.7.8.5 Alternative name(s): Phosphatidylglycerophosphate synthase Short name= PGP synthase

Gene Names:Name:pgsA Ordered Locus Names:RHOS4_26890 ORF Names:RSP_1073

Expression Region:1-221

Sequence Info:full length protein

30 other products in the same category: