View larger

Recombinant Bacillus subtilis Uncharacterized membrane protein ykoX(ykoX)

CSB-CF518550BRJ

Recombinant Bacillus subtilis Uncharacterized membrane protein ykoX(ykoX)

See below for Detailed Description

More details

CAD$1,568.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O34908

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIHKHETRELVAIEELVMSWIEAFKSLSYFGIFLALSIEFIPAEVVLPLAGYWVSKGDMT LAGVVLAGSLGGVAGPLTLYWIGRYGGRPFLERFGKYLFIKPEALDKSDNFFKKHGGFVA FSGRFLPGIRTLISIPCGIAKMNVWVFSLYTFIAMLPITFVYVYLGVKLGENWKAVGSIL DQYMLPIGIAILALFLLYLLMKKRKKRTHSEQLSVFLKNKR

Protein Names:Recommended name: Uncharacterized membrane protein ykoX

Gene Names:Name:ykoX Ordered Locus Names:BSU13430

Expression Region:1-221

Sequence Info:full length protein

30 other products in the same category: