View larger

Recombinant Haloquadratum walsbyi Putative cobalt transport protein CbiM(cbiM)

CSB-CF619275HAAE

Recombinant Haloquadratum walsbyi Putative cobalt transport protein CbiM(cbiM)

See below for Detailed Description

More details

CAD$1,567.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haloquadratum walsbyi (strain DSM 16790)

Uniprot NO.:Q18J48

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHIMEGFLPPRWAAAWTLAAAPIVVYGAKQTIDIIRQDARVKALVAIGIAFVFILSALKF PSVTGSTSHPTGTGLLVVLFGPAVTAFTATIVLLYQALLLAHGGITTLGANVVAMGIIGP TVGWTAYQIIRPYTSLERATFIAAVLTDWTTYLVTSLQLGAAFPAGDGLDAIIISALDFA AIFTLTQVPIGILEGILAAAVIGYLTRLGSETIESLEVAA

Protein Names:Recommended name: Putative cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM

Gene Names:Name:cbiM Ordered Locus Names:HQ1835A

Expression Region:1-220

Sequence Info:full length protein

30 other products in the same category: