View larger

Recombinant Human Leukocyte surface antigen CD53(CD53)

CSB-CF004944HU

Recombinant Human Leukocyte surface antigen CD53(CD53)

See below for Detailed Description

More details

CAD$1,566.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P19397

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVG SIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTD SIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS NFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL

Protein Names:Recommended name: Leukocyte surface antigen CD53 Alternative name(s): Cell surface glycoprotein CD53 Tetraspanin-25 Short name= Tspan-25 CD_antigen= CD53

Gene Names:Name:CD53 Synonyms:MOX44, TSPAN25

Expression Region:1-219

Sequence Info:Full length protein

30 other products in the same category: