View larger

Recombinant Mouse Claudin-3(Cldn3)

CSB-CF897449MO

Recombinant Mouse Claudin-3(Cldn3)

See below for Detailed Description

More details

CAD$1,566.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9Z0G9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAGLYVGWAAAALQLLGGALL CCSCPPRDKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV

Protein Names:Recommended name: Claudin-3 Alternative name(s): Clostridium perfringens enterotoxin receptor 2 Short name= CPE-R 2 Short name= CPE-receptor 2

Gene Names:Name:Cldn3 Synonyms:Cpetr2

Expression Region:1-219

Sequence Info:full length protein

30 other products in the same category: