View larger

Recombinant Rat Claudin-3(Cldn3)

CSB-CF723578RA

Recombinant Rat Claudin-3(Cldn3)

See below for Detailed Description

More details

CAD$1,566.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q63400

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA GVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALL CCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV

Protein Names:Recommended name: Claudin-3 Alternative name(s): Rat ventral prostate.1 protein Short name= RVP1

Gene Names:Name:Cldn3

Expression Region:1-219

Sequence Info:full length protein

30 other products in the same category: