View larger

Recombinant Danio rerio Transmembrane protein 17A(tmem17a)

CSB-CF703475DIL

Recombinant Danio rerio Transmembrane protein 17A(tmem17a)

See below for Detailed Description

More details

CAD$1,566.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q502E0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPVFYTPIPQNLRVGLANVSGSVFINNRTRDSADFKDHYLENEACAEVSSHLPLQMMLYF NMFFFPFWWISELLMLQLKFSYLPVYYQCLLVTGMVLISIFEVLRMYLGYAGNLKEKVPE LAGFWLISFLFQLPILLFFITDPDIIILPLERAVHSLYLAFLLGELMASFLALRVMTRKL AQQFHMRQFGHVQGLHTAEALPMFGLPYGGRSVLPVQDI

Protein Names:Recommended name: Transmembrane protein 17A

Gene Names:Name:tmem17a ORF Names:zgc:112294

Expression Region:1-219

Sequence Info:full length protein

30 other products in the same category: