View larger

Recombinant Human Transmembrane protein 179B(TMEM179B)

CSB-CF023762HU

Recombinant Human Transmembrane protein 179B(TMEM179B)

See below for Detailed Description

More details

CAD$1,566.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q7Z7N9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALSWLQRVELALFAAAFLCGAVAAAAMTRTQGSFSGRCPLYGVATLNGSSLALSRPSAP SLCYFVAGASGLLALYCLLLLLFWIYSSCIEDSHRGAIGLRIALAISAIAVFLVLVSACI LRFGTRSLCNSIISLNTTISCSEAQKIPWTPPGTALQFYSNLHNAETSSWVNLVLWCVVL VLQVVQWKSEATPYRPLERGDPEWSSETDALVGSRLSHS

Protein Names:Recommended name: Transmembrane protein 179B

Gene Names:Name:TMEM179B

Expression Region:1-219

Sequence Info:full length protein

30 other products in the same category: