View larger

Recombinant Inner membrane protein YghB(yghB)

CSB-CF364441EOD

Recombinant Inner membrane protein YghB(yghB)

See below for Detailed Description

More details

CAD$1,566.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P0AA62

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVIQDIIAALWQHDFAALADPHIVSVVYFVMFATLFLENGLLPASFLPGDSLLILAGAL IAQGVMDFLPTIAILTAAASLGCWLSYIQGRWLGNTKTVKGWLAQLPAKYHQRATCMFDR HGLLALLAGRFLAFVRTLLPTMAGISGLPNRRFQFFNWLSGLLWVSVVTSFGYALSMIPF VKRHEDQVMTFLMILPIALLTAGLLGTLFVVIKKKYCNA

Protein Names:Recommended name: Inner membrane protein YghB

Gene Names:Name:yghB Ordered Locus Names:Z4362, ECs3893

Expression Region:1-219

Sequence Info:full length protein

30 other products in the same category: