View larger

Recombinant Bacillus subtilis Arginine transport system permease protein ArtQ(artQ)

CSB-CF344982BRJ

Recombinant Bacillus subtilis Arginine transport system permease protein ArtQ(artQ)

See below for Detailed Description

More details

CAD$1,566.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P54536

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLDFSATIPQIPFILEGLAITLKIVVVSAIIGLILGIVLSLCKISTFRPFIWIADFYTS VFRGTPLVLQLMIVYFGLPQLLGFQIDQFWAAVVALSLNSAAYVSEIIRAGINAIDKGQK EAAVALGVPYGKMMKDLLLPQAFKNISPAIVNELITLTKESAIVTVIGLGDVMRRAYQAG AATYNYLEPLIIAGLIYYVLVLILTFIGKAVERKLKSND

Protein Names:Recommended name: Arginine transport system permease protein ArtQ

Gene Names:Name:artQ Synonyms:yqiY Ordered Locus Names:BSU23970

Expression Region:1-219

Sequence Info:full length protein

30 other products in the same category: