View larger

Recombinant Rat Leukocyte surface antigen CD53(Cd53)

CSB-CF004944RA

Recombinant Rat Leukocyte surface antigen CD53(Cd53)

See below for Detailed Description

More details

CAD$1,565.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P24485

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GMSSLKLLKYVLFFFNFLFWVCGCCILGFGIHLLVQNTYGILFRNLPFLTLGNVLVIVGS IIMVVAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDS IQHYHSDNSTRMAWDFIQSQLQCCGVNGSSDWISGPPSSCPSGADVQGCYKKGQAWFHSN FLYIGIVTICVCVIQVLGMSFALTLNCQIDKTSQALGL

Protein Names:Recommended name: Leukocyte surface antigen CD53 Alternative name(s): Cell surface glycoprotein CD53 Leukocyte antigen MRC OX-44 CD_antigen= CD53

Gene Names:Name:Cd53 Synonyms:Ox-44

Expression Region:2-219

Sequence Info:Full length protein

30 other products in the same category: