View larger

Recombinant Moorella thermoacetica ATP synthase subunit a(atpB)

CSB-CF646947MUG

Recombinant Moorella thermoacetica ATP synthase subunit a(atpB)

See below for Detailed Description

More details

CAD$1,565.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Moorella thermoacetica (strain ATCC 39073)

Uniprot NO.:Q2RFX3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTHVRPVEIFHLGPIPIYSTVVNTWIIMILLLAGIFLATRKLSFIPRGAQHVLEMFLEFF YGLLEEIIGKEGRRYLPLVATLFIFILSLNLSWFIPGMKPPTMDLSTTAAFAVTTIILVQ IFGIRKLGLRGYIRHFFQPAPFLFPLNVIEELVKPVSLSLRLFGNLFGEEMVVTILFLMI PFLLPTPIMLLGVLMGTIQAFVFTLLTITYIANFVHGH

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6

Gene Names:Name:atpB Ordered Locus Names:Moth_2384

Expression Region:1-218

Sequence Info:full length protein

30 other products in the same category: