View larger

Recombinant Prochlorococcus marinus Cytochrome b6(petB)

CSB-CF430868PZC

Recombinant Prochlorococcus marinus Cytochrome b6(petB)

See below for Detailed Description

More details

CAD$1,565.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Prochlorococcus marinus (strain MIT 9211)

Uniprot NO.:A9BDY2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANSSPVYDWFQERLEIQDIADDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVTEAYSSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WVTGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDFMVELLRGGESVGQ TTLTRFYSLHTFVLPWTLAVFMLMHFLMIRKQGISGPL

Protein Names:Recommended name: Cytochrome b6

Gene Names:Name:petB Ordered Locus Names:P9211_03611

Expression Region:1-218

Sequence Info:full length protein

30 other products in the same category: